PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g021090.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 280aa    MW: 32565.5 Da    PI: 7.5875
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g021090.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.41.3e-48171412128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                          pGfrFhPtdeel+ +yL++kve+k++++ e i+++diyk++PwdLp   ka++ke+y+F+ r +ky+++ r+nr+tk g+Wkatg dk+v
  Solyc05g021090.2.1  17 LPGFRFHPTDEELIGFYLRRKVENKRISM-ELIRHIDIYKYDPWDLP---KADDKEMYYFCMRGRKYKNSVRPNRVTKGGFWKATGIDKPV 103
                         69***************************.99***************...56899************************************ PP

                 NAM  93 lskkgel..vglkktLvfykgrapkgektdWvmheyrl 128
                         +s++++   +glkk Lv+y+g+a kg+ktdW+mhe+rl
  Solyc05g021090.2.1 104 YSSTTKCiiIGLKKCLVYYRGSAGKGTKTDWMMHEFRL 141
                         **84433459**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-5315162IPR003441NAC domain
PROSITE profilePS5100552.09516162IPR003441NAC domain
PfamPF023653.7E-2418141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MVDEIKTMSK EEEDVILPGF RFHPTDEELI GFYLRRKVEN KRISMELIRH IDIYKYDPWD  60
LPKADDKEMY YFCMRGRKYK NSVRPNRVTK GGFWKATGID KPVYSSTTKC IIIGLKKCLV  120
YYRGSAGKGT KTDWMMHEFR LPPTSNTNQQ AEVWTLCRIF KRSSSTYTRS SYNTQEVKHP  180
IGDASSKACS LESDENSTDH DHSNSFRDMS FPHQNYNNYV AQMDETRNQQ NPIPHESTFP  240
SSSSISFWNT NSTQEDYLFG DHGNKWDDLK SIVDLATMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-461816619169NO APICAL MERISTEM PROTEIN
1ut4_B2e-461816619169NO APICAL MERISTEM PROTEIN
1ut7_A2e-461816619169NO APICAL MERISTEM PROTEIN
1ut7_B2e-461816619169NO APICAL MERISTEM PROTEIN
3swm_A3e-461816622172NAC domain-containing protein 19
3swm_B3e-461816622172NAC domain-containing protein 19
3swm_C3e-461816622172NAC domain-containing protein 19
3swm_D3e-461816622172NAC domain-containing protein 19
3swp_A3e-461816622172NAC domain-containing protein 19
3swp_B3e-461816622172NAC domain-containing protein 19
3swp_C3e-461816622172NAC domain-containing protein 19
3swp_D3e-461816622172NAC domain-containing protein 19
4dul_A2e-461816619169NAC domain-containing protein 19
4dul_B2e-461816619169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153624e-13Solanum lycopersicum chromosome 2 clone C02HBa0027B01, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015159594.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK551e-87NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLK4BZF90.0K4BZF9_SOLLC; Uncharacterized protein
STRINGSolyc05g021090.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-82NAC domain containing protein 42
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]